PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G094200.1
Common NamePOPTR_0003s09300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 336aa    MW: 37486 Da    PI: 6.949
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G094200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT++Ede+l+d++k+ G ++Wk+ +   g++R++k+c++rw +yl
  Potri.003G094200.1 15 KGPWTPDEDEKLIDYIKRNGHENWKALPMLAGLNRCGKSCRLRWTNYL 62
                        79********************************************97 PP

2Myb_DNA-binding53.26.9e-1768112147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg++++eE+  +v+++  lG++ W++Ia++++ gRt++++k++w+++
  Potri.003G094200.1  68 RGKFSEEEERVIVNLHSALGNK-WSRIANHLP-GRTDNEIKNFWNTH 112
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6231062IPR017930Myb domain
SuperFamilySSF466895.24E-3013109IPR009057Homeodomain-like
SMARTSM007171.8E-141464IPR001005SANT/Myb domain
PfamPF002494.8E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-231669IPR009057Homeodomain-like
CDDcd001673.46E-111762No hitNo description
PROSITE profilePS5129427.19563117IPR017930Myb domain
SMARTSM007178.9E-1667115IPR001005SANT/Myb domain
PfamPF002493.7E-1568112IPR001005SANT/Myb domain
CDDcd001671.09E-1170113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVRSPCSPGA SALKKGPWTP DEDEKLIDYI KRNGHENWKA LPMLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEERVIV NLHSALGNKW SRIANHLPGR TDNEIKNFWN THIRKKLLQM  120
GIDPNTHKPR TDLSHFLNLS QLLGAAQFGN IASPWNNFLK LQAEATQLAN IQLLRNLLQM  180
MNTNTLTNIE SNSLLGSQNP HQFRGLVNGT TISNTNEPTT ISQDLVNPPV TPQVHNDFQA  240
ISKLWASCEG GFGPEGLNIN GDTLSSSYGI QTEQNPLPAL VSASTSPVTS IDYQTERKGD  300
PSNYSTGTPT STIFEAWEKL IDDDNYSSYW NDILE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2991171108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304344.10.0hypothetical protein POPTR_0003s09300g
TrEMBLB9GZ980.0B9GZ98_POPTR; Uncharacterized protein
STRINGPOPTR_0003s09300.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-83myb domain protein 9